HORDB

ID: hor005905
Uniprot ID: O93464
Protein name: Cholecystokinin-26
Gene name: cck
Organism: Carassius auratus (Goldfish)
Family: Gastrin/cholecystokinin family
Source: animal
Expression: By lipopolysaccharide (LPS); in hypothalamus. |Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other se
Disease: NA
Comments: NA
Taxonomy: Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0007165 signal transduction; GO:0007586 digestion; GO:0007631 feeding behavior; GO:0030072 peptide hormone secretion; GO:0030252 growth hormone secretion
GO CC: GO:0005576 extracellular region

Sequence: SPSPKSKSMGNNHRIKDRDYLGWMDF
Length: 26
Propeptide: MNAGICVCVLLAALSTSSCLSLPAVSEDGGQSDLGIVMEHTRHTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDFGRRSAEEYEYSS
Signal peptide: MNAGICVCVLLAALSTSSC
Modification: T20 Sulfotyrosine;T26 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005905_AF2.pdb

hor005905_ESM.pdb

Mass:	351353	Formula:	C133H204N40O40S2
Absent amino acids:	ACEQTV	Common amino acids:	S
pI:	10.11	Basic residues:	6
Polar residues:	9	Hydrophobic residues:	4
Hydrophobicity:	-138.08	Boman Index:	-8260
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	30
Instability Index:	5234.62	Extinction Coefficient cystines:	6990
Absorbance 280nm:	279.6

PubMed ID: 9493851
Title: Molecular cloning and expression of cDNA encoding brain preprocholecystokinin in goldfish.
PubMed ID: 8262360
Title: CCK/gastrin-like immunoreactivity in the goldfish pituitary: regulation of pituitary hormone secretion by CCK-like peptides in vitro.
PubMed ID: 8092330
Title: CCK/gastrin-like immunoreactivity in brain and gut, and CCK suppression of feeding in goldfish.
PubMed ID: 10640690
Title: Postprandial, seasonal and sexual variations in cholecystokinin gene expression in goldfish brain.
PubMed ID: 12124755
Title: Distribution of cholecystokinin, calcitonin gene-related peptide, neuropeptide Y, and galanin in the primary gustatory nuclei of the goldfish.
PubMed ID: 14751584
Title: Effects of lipopolysaccharide treatment on feeding of goldfish: role of appetite-regulating peptides.
PubMed ID: 15256279
Title: Effects of cholecystokinin and bombesin on the expression of preprosomatostatin-encoding genes in goldfish forebrain.